PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG006180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family VOZ
Protein Properties Length: 503aa    MW: 55791.6 Da    PI: 5.524
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG006180.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ429.93.7e-1322234401217
          VOZ   1 pppsaflgpkcalwdctrpaqg.sewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfd 97 
                  pppsaflgp calwdc+rpaqg  ew++dycssfh +la+ eg+pg++pvlrp+gi+lkdgllfaalsak++gk vgipecegaatakspwna+elfd
  CCG006180.1 223 PPPSAFLGPTCALWDCPRPAQGgLEWFRDYCSSFHHSLAFSEGPPGMSPVLRPGGIGLKDGLLFAALSAKAEGKGVGIPECEGAATAKSPWNAPELFD 320
                  89******************9648************************************************************************** PP

          VOZ  98 lsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekks 195
                  ls+legetirewlffdkprrafesgnrkqrslpdy+grgwhesrkq+m+efgglkrsyymdpqp+++fewhlyeyein++da+alyrlelk vd+kks
  CCG006180.1 321 LSVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYTGRGWHESRKQIMNEFGGLKRSYYMDPQPLNNFEWHLYEYEINKCDACALYRLELKAVDGKKS 418
                  ************************************************************************************************** PP

          VOZ 196 akgkvskdsladlqkklgrlta 217
                  akgk++++s+adlqk++grlta
  CCG006180.1 419 AKGKIANESVADLQKQMGRLTA 440
                  ********************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MAIMGFVESK GSATVMGKGS KINCKSASHK LFKDKAKNRV DDLQGMFLDL QFARKESRTV  60
DVAVLEEQVH QMLREWKAEL NEPSPASSLQ QGGSLGSFST DICRLLQLCE EEDDATSALA  120
APKLEPNDQS MQGGDNVVFQ EEYAVNHGQQ EHAFPFVDQC KDSLSGVRSL AINNIEGAAQ  180
LDYHQFDLPQ SFEQNFYASF NGTDLGEEDG MHHVSSYLPS MCPPPSAFLG PTCALWDCPR  240
PAQGGLEWFR DYCSSFHHSL AFSEGPPGMS PVLRPGGIGL KDGLLFAALS AKAEGKGVGI  300
PECEGAATAK SPWNAPELFD LSVLEGETIR EWLFFDKPRR AFESGNRKQR SLPDYTGRGW  360
HESRKQIMNE FGGLKRSYYM DPQPLNNFEW HLYEYEINKC DACALYRLEL KAVDGKKSAK  420
GKIANESVAD LQKQMGRLTA EFPPDNKRAV KGRTKVNAKV GNVYSGSTQV APSNEAYDYG  480
PGSQYDYLVE NLKGYYLTQF KKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027748.10.0PREDICTED: transcription factor VOZ1
RefseqXP_011027749.10.0PREDICTED: transcription factor VOZ1
RefseqXP_011027752.10.0PREDICTED: transcription factor VOZ1
RefseqXP_011027753.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLB9H2N90.0B9H2N9_POPTR; Uncharacterized protein
STRINGPOPTR_0004s05030.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein